You have no items in your shopping cart.
Cart summary
Item 1 of 1
PCTK3 Rabbit Polyclonal Antibody
Catalog Number: orb327618
| Catalog Number | orb327618 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CDK18 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Mouse, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PCTK3 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 57kDa |
| Target | CDK18 |
| UniProt ID | Q07002 |
| Protein Sequence | Synthetic peptide located within the following region: IMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLG |
| NCBI | NP_997668 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti PCTAIRE antibody, anti PCTAIRE3 antibody, ant Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PCTK3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
- Item 1 of 3
PCTAIRE3 (PCTK3) Antibody (N-term) [orb1929166]
IHC-P, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
PCTK3 Rabbit Polyclonal Antibody (HRP) [orb2081381]
WB
Bovine, Human, Mouse, Rat
Rabbit
Polyclonal
HRP
100 μl
