CDK11A Rabbit Polyclonal Antibody

SKU: orb331151

Description

Rabbit polyclonal antibody to CDK11A

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: CDK11A
• Protein Sequence: Synthetic peptide located within the following region: EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL
• Molecular Weight: 84kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CDC2L2 antibody, anti CDC2L3 antibody, anti p58GTA antibody, anti PITSLRE antibody, anti CDK11-p46 antibody, anti CDK11-p58 antibody, anti CDK11-p110 antibody

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): MCF7 Cell Lysate (N10), Antibody concentration: 1 ug/ml.

WB Suggested Anti-CDK11A Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.

Quick Database Links

Gene Symbol

CDK11A

UniProt

Q9UQ88

RefSeq (Protein):NP_277071