CDH16 Rabbit Polyclonal Antibody

SKU: orb578106

Description

Rabbit polyclonal antibody to Cadherin-17

Research Area

Cell Biology, Disease Biomarkers, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDH16
• Target: CDH16
• Protein Sequence: Synthetic peptide located within the following region: SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD
• Molecular Weight: 90 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 5 ug/ml.

Immunohistochemistry with Kidney tissue at an antibody concentration of 5 ug/ml using anti-CDH16 antibody (orb578106).

WB Suggested Anti-CDH16 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Quick Database Links

Gene Symbol

CDH16

UniProt

O75309

RefSeq (Protein):NP_004053