CDC42EP1 Rabbit Polyclonal Antibody

• Catalog Number: orb586406
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDC42EP1
• Target: CDC42EP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDC42EP1
• Protein Sequence: Synthetic peptide located within the following region: HTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPP
• UniProt ID: Q00587
• MW: 40kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CEP1, BORG5, MSE55
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_689449
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-CDC42EP1 Antibody, Titration: 1.0 ug/ml, Positive Control: THP-1 Whole Cell.