CDC26 Rabbit Polyclonal Antibody

• Catalog Number: orb584275
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDC26
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDC26
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 10kDa
• Target: CDC26
• UniProt ID: Q8NHZ8
• Protein Sequence: Synthetic peptide located within the following region: NIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ
• NCBI: NP_644815
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: APC12, ANAPC12, C9orf17
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 20 ug Jukart cell lysate, 2: 20 ug untransfected Hela lysate, 3: 20 ug GFP-STAMBP transfected HeLa lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:2000, Gene Name: CDC26.

WB Suggested Anti-CDC26 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: A549 cell lysate.