CDC25C monoclonal antibody (M01), clone 3B11

• Catalog Number: orb2294692
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDC25C.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B11
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
• NCBI: AAH19089
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDC25C monoclonal antibody (M01), clone 3B11 Western Blot analysis of CDC25C expression in HeLa.

Detection limit for recombinant GST tagged CDC25C is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 ug/ml].

Immunoprecipitation of CDC25C transfected lysate using anti-CDC25C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDC25C MaxPab rabbit polyclonal antibody.

Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody (M01), clone 3B11. Lane 1: CDC25C transfected lysate(53.312 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDC25C monoclonal antibody (M01), clone 3B11 (Cat # orb2294692). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).