CDC2 monoclonal antibody (M04), clone 8F1

• Catalog Number: orb2294710
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDC2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Lambda
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 8F1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH14563

CDC2 monoclonal antibody (M04), clone 8F1 Western Blot analysis of CDC2 expression in Hela S3 NE.

CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in NIH/3T3.

CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in PC-12.

CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in Raw 264.7.

Detection limit for recombinant GST tagged CDC2 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml].

Western Blot detection against Immunogen (35.31 KDa).