CDC14A Rabbit Polyclonal Antibody

• Catalog Number: orb585938
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDC14A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: CDC14A
• UniProt ID: Q9UNH5
• Protein Sequence: Synthetic peptide located within the following region: DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR
• NCBI: NP_003663
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: cdc14, DFNB32, DFNB35, hCDC14, DFNB105
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CDC14A Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell. CDC14A is strongly supported by BioGPS gene expression data to be expressed in Human RPMI-8226 cells.