You have no items in your shopping cart.
Cart summary
Item 1 of 1
CDADC1 Rabbit Polyclonal Antibody
Catalog Number: orb326748
| Catalog Number | orb326748 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CDADC1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Equine |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDADC1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 57kDa |
| Target | CDADC1 |
| UniProt ID | Q9BWV3 |
| Protein Sequence | Synthetic peptide located within the following region: EGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGI |
| NCBI | NP_112173 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti NYD-SP15 antibody, anti bA103J18.1 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 1
CDADC1 Rabbit Polyclonal Antibody (Biotin) [orb2088490]
WB
Equine, Human
Rabbit
Polyclonal
Biotin
100 μl
