You have no items in your shopping cart.
Cart summary
CDA2 Protein, S. cerevisiae, Recombinant (His)
Catalog Number: orb1976484
| Catalog Number | orb1976484 |
|---|---|
| Category | Proteins |
| Description | Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate. Chitosan is a component of the spore wall. CDA2 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.9 kDa and the accession number is Q06703. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 34.9 kDa (predicted) |
| UniProt ID | Q06703 |
| Protein Sequence | EANREDLKQIDFQFPVLERAATKTPFPDWLSAFTGLKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTVDLAIKINKLIGDDQSTVSHCVGGIDYIKEFLS |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Saccharomyces cerevisiae |
| Biological Activity | Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate. Chitosan is a component of the spore wall. CDA2 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.9 kDa and the accession number is Q06703. |
| Expression Region | 26-312 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
