CD9 monoclonal antibody (M01), clone 4A2

• Catalog Number: orb2294913
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD9.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
• Tested applications: ELISA, IF, WB
• Clone Number: 4A2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH11988

Detection limit for recombinant GST tagged CD9 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CD9 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (34.98 KDa).