CD3EAP Peptide - N-terminal region

• Catalog Number: orb1998597
• Category: Proteins
• Description: CD3EAP Peptide - N-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: AARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNG
• UniProt ID: O15446
• MW: 55 kDa
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: ASE1, CAST, ASE-1, PAF49
• Note: For research use only
• NCBI: NP_001284519.1
• Expiration Date: 6 months from date of receipt.