CD3E Rabbit Polyclonal Antibody

SKU: orb584219

Description

CD3E Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CD3E. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CD3E. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD3E
• Target: CD3E
• Protein Sequence: Synthetic peptide located within the following region: QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

T3E, TCRE, IMD18

Rabbit Anti-CD3E Antibody, Catalog Number: orb584219, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CD3E Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.

Quick Database Links

Gene Symbol

CD3E

UniProt

P07766

RefSeq (Protein):NP_000724