CD284 antibody

• Catalog Number: orb431067
• Category: Antibodies
• Description: Goat polyclonal antibody to CD284
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Reactivity: Human
• Isotype: Polyclonal IgG
• Immunogen: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
• Concentration: 1.0mg/ml
• Form/Appearance: Purified IgG - liquid
• Purity: Purified
• Conjugation: Unconjugated
• Target: CD284
• Storage: +4°C, -20°C if preferred
• Buffer/Preservatives: 0.1% Sodium Azide (NaN3) 0.1% Bovine Serum Albumin. Phosphate buffered saline
• Alternative names: TLR4
• Note: For research use only
• Application notes: (N-TERMINAL)
• Expiration Date: 12 months from date of receipt.