You have no items in your shopping cart.
Cart summary
CD1C Recombinant Protein (Human)
Catalog Number: orb2053121
| Catalog Number | orb2053121 |
|---|---|
| Category | Proteins |
| Description | CD1C Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34.2 kDa |
| UniProt ID | P29017 |
| Protein Sequence | NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM |
| Source | Yeast |
| NCBI | NP_001756 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | BDCA1;CD1;CD1A;CD1C antigen, c polypeptide;cortica Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CD1C protein [orb358850]
Greater than 90% as determined by SDS-PAGE.
36.2 kDa
E.coli
20 μg, 100 μg, 1 mgHuman CD1C protein [orb383095]
Greater than 90% as determined by SDS-PAGE.
34.2 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgRecombinant Human CD1C Protein, His Tag [orb1553474]
≥90% as determined by SDS-PAGE
This protein contains the human CD1C(Met1-Met302) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgCD1C Recombinant Protein (Human) [orb2053120]
Greater than 90% as determined by SDS-PAGE.
34.2 kDa
Yeast
500 μgCD1C Recombinant Protein (Human) [orb2053122]
Greater than 90% as determined by SDS-PAGE.
34.2 kDa
Yeast
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
