You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2053120 |
---|---|
Category | Proteins |
Description | CD1C Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 34.2 kDa |
UniProt ID | P29017 |
Protein Sequence | NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM |
Source | Yeast |
NCBI | NP_001756 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | BDCA1;CD1;CD1A;CD1C antigen, c polypeptide;cortica Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
36.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
34.2 kDa | |
Yeast |
≥90% as determined by SDS-PAGE | |
This protein contains the human CD1C(Met1-Met302) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Greater than 90% as determined by SDS-PAGE. | |
34.2 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
34.2 kDa | |
Yeast |
Filter by Rating