CD19 monoclonal antibody (M02), clone 1C9

• Catalog Number: orb2294903
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD19.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
• Tested applications: ELISA, IF, WB
• Clone Number: 1C9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001761

Detection limit for recombinant GST tagged CD19 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CD19 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (35.64 KDa).