You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294904 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CD19. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In ascites fluid |
Immunogen | CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD |
Tested applications | ELISA, WB |
Clone Number | 1G3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001761 |
Western Blot analysis of CD19 expression in transfected 293T cell line by CD19 monoclonal antibody (M01A), clone 1G3. Lane 1: CD19 transfected lysate(61.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.64 KDa).