CD19 monoclonal antibody (M01), clone 1G3

• Catalog Number: orb2294905
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD19.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G3
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
• NCBI: NP_001761
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of CD19 transfected lysate using anti-CD19 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD19 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CD19 expression in transfected 293T cell line by CD19 monoclonal antibody (M01), clone 1G3. Lane 1: CD19 transfected lysate(61.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.64 KDa).