Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CCSAP Rabbit Polyclonal Antibody

SKU: orb589533

Description

Rabbit polyclonal antibody to CCSAP

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C1ORF96
TargetCCSAP
Protein SequenceSynthetic peptide located within the following region: KDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSK
Molecular Weight29 kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CSAP, C1orf96

Similar Products

  • C1orf96 Polyclonal Antibody [orb1416253]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • CCSAP Rabbit Polyclonal Antibody [orb3071437]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 30 μl, 200 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CCSAP Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CCSAP Rabbit Polyclonal Antibody (orb589533)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry