You have no items in your shopping cart.
Cart summary
Item 1 of 1
CCR2 Rabbit Polyclonal Antibody
Catalog Number: orb573688
| Catalog Number | orb573688 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CCR2 |
| Target | CCR2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCR2 |
| Protein Sequence | Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF |
| UniProt ID | P41597 |
| MW | 39kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CKR2, CCR-2, CCR2A, CCR2B, CD192, CKR2A, CKR2B, CM Read more... |
| Note | For research use only |
| NCBI | NP_001116868 |
Sample Type: Esophagus Tumor lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
CCR-2 Rabbit Polyclonal Antibody [orb10269]
FC, IF, IHC-Fr, IHC-P
Canine, Equine, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 2
- Item 1 of 2
