CCND3 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294973
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CCND3 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human
• Immunogen: CCND3 (NP_001751.1, 1 a.a. ~ 292 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
• NCBI: NP_001751.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CCND3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CCND3 expression in Jurkat.

Proximity Ligation Analysis of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with anti-CCND3 rabbit purified polyclonal 1:1200 and anti-AREG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CCND3 expression in transfected 293T cell line by CCND3 MaxPab polyclonal antibody. Lane 1: CCND3 transfected lysate(32.50 KDa). Lane 2: Non-transfected lysate.