You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294974 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human CCND3 protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CCND3 (NP_001751, 1 a.a. ~ 292 a.a) full-length human protein. |
Protein Sequence | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
Tested applications | IF, IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001751 |
Immunofluorescence of purified MaxPab antibody to CCND3 on HeLa cell. [antibody concentration 7 ug/ml].
Immunoperoxidase of purified MaxPab antibody to CCND3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml].
Western Blot analysis of CCND3 expression in transfected 293T cell line by CCND3 MaxPab polyclonal antibody. Lane 1: CCND3 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate.