CCND2 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294976
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CCND2 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CCND2 (NP_001750.1, 1 a.a. ~ 289 a.a) full-length human protein.
• Protein Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
• Tested applications: IF, PLA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001750.1

Immunofluorescence of purified MaxPab antibody to CCND2 on HeLa cell. [antibody concentration 30 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CCND2 and CDKN1A. HeLa cells were stained with anti-CCND2 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 MaxPab polyclonal antibody. Lane 1: CCND2 transfected lysate(33.10 KDa). Lane 2: Non-transfected lysate.