Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CCNB1 Rabbit Polyclonal Antibody

SKU: orb573589

Description

Rabbit polyclonal antibody to CCNB1

Research Area

Cell Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIP, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CCNB1
TargetCCNB1
Protein SequenceSynthetic peptide located within the following region: YTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
Molecular Weight48kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CCNB

Similar Products

  • Cyclin B1 Rabbit Polyclonal Antibody [orb10494]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cyclin B1/CCNB1 Rabbit Polyclonal Antibody [orb654315]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Cyclin B1 (phospho Ser126) rabbit pAb Antibody [orb764169]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • CCNB1 Rabbit Polyclonal Antibody [orb626160]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Phospho-Cyclin B1 (Ser126) Rabbit Polyclonal Antibody [orb5928]

    ICC,  IF,  IHC-Fr,  IHC-P

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CCNB1 Rabbit Polyclonal Antibody

Rabbit Anti-CCNB1 Antibody, Catalog Number: orb573589, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

CCNB1 Rabbit Polyclonal Antibody

Application: IP, Species+tissue/cell type: Mouse brain homogenate, How many ug'sof tissue/cell lysate run on the gel: 500 ug mouse brain homogenateIP antibody: 6 ug, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:5000.

CCNB1 Rabbit Polyclonal Antibody

Application:Western blotting, Species+tissue/cell type: lane 1: 60 ug human NT2 cell line, Primary antibody dilution: 1:500, Secondary antibody:IRDye 800 CW goat anti-rabbit, Secondary antibody dilution: 1:20000.

CCNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-CCNB1 Antibody, Positive Control: Lane 1: 60 ug human NT2 cell line, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

CCNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-CCNB1 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CCNB1 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_114172

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IP
Immunoprecipitation
View Protocol

CCNB1 Rabbit Polyclonal Antibody (orb573589)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry