You have no items in your shopping cart.
Cart summary
CCL5 Protein, Mouse, Recombinant
Catalog Number: orb2815979
| Catalog Number | orb2815979 |
|---|---|
| Category | Proteins |
| Description | CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882. |
| Tag | Tag Free |
| Protein Sequence | SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
| UniProt ID | P30882 |
| MW | 7.9 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Expression Region | 24-91 aa |
| Storage | -20°C |
| Note | For research use only |
- Item 1 of 1
Mouse RANTES protein (Active) [orb359106]
> 97% as determined by SDS-PAGE and HPLC.
7.9 kDa
E.Coli
5 μg, 100 μg, 500 μg IRAK3 Protein, Mouse, Recombinant (His & Myc) [orb1977182]
98.00%
72.3 kDa (predicted)
500 μg, 100 μg, 20 μgRecombinant Mouse C-C motif chemokine 5 protein(Ccl5) (Active) [orb1650791]
500 μg, 100 μg, 1 mg, 20 μg, 250 μg, 5 μgCCL5 Protein, Mouse, Recombinant (hFc) [orb1960868]
> 95%
35.2 kDa (predicted). Due to glycosylation, the protein migrates to 40-45 kDa based on Tris-Bis PAGE result.
500 μg, 100 μg, 1 mgMouse Rantes Protein [orb428063]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
5 μg, 20 μg, 1 mg
