You have no items in your shopping cart.
Cart summary
CCL27 Protein, Human, Recombinant (Active)
Catalog Number: orb2816362
| Catalog Number | orb2816362 |
|---|---|
| Category | Proteins |
| Description | CCL27 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9Y4X3. |
| Tag | Tag Free |
| MW | 10.1 kDa (Predicted) |
| UniProt ID | Q9Y4X3 |
| Protein Sequence | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 25-112 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CCL27 protein (Active) [orb359084]
> 96% as determined by SDS-PAGE and HPLC.
10.1 kDa
E.Coli
5 μg, 100 μg, 500 μg Recombinant Human C-C motif chemokine 27 protein(CCL27) (Active) [orb1650803]
500 μg, 20 μg, 100 μg, 1 mg, 5 μg, 250 μg
