CCKBR Antibody

• Catalog Number: orb413077
• Category: Antibodies
• Description: CCKBR Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/mlImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 64 kDa
• UniProt ID: P32239
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Gastrin/cholecystokinin type B receptor; CCK-B rec
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of LOVO cells using anti-CCKBR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of CCKBR using anti-CCKBR antibody.Lane 1:human PANC-1 cell;2:human U-87MG cell;3:human COLO-320 cell;4:human SGC-7901 cell.

WB analysis of CCKBR using anti-CCKBR antibody.Lane 1:rat brain tissue;2:rat stomach tissue;3:mouse brain tissue.