CCDC86 Rabbit Polyclonal Antibody

SKU: orb326747

Description

Rabbit polyclonal antibody to CCDC86

Research Area

Epigenetics, Infectious Diseases

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC86
• Target: CCDC86
• Protein Sequence: Synthetic peptide located within the following region: ESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAP
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, CCDC86 is supported by BioGPS gene expression data to be expressed in MCF7.

Quick Database Links

Gene Symbol

CCDC86

UniProt

Q9H6F5

RefSeq (Protein):NP_077003