CCDC7 Rabbit Polyclonal Antibody

SKU: orb325893

Description

Rabbit polyclonal antibody to C10orf68

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: CCDC7
• Protein Sequence: Synthetic peptide located within the following region: EQTYQAAEKSQAHNEVPNERLVVEHQESLSKTKLQIKKQETSTEQPLTTP
• Molecular Weight: 69kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ13031 antibody, anti MGC149767 antibody, anti dJ1104A8.1 antibody, anti RP11-479G22.1 antibody

WB Suggested Anti-C10orf68 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell, C10orf68 is supported by BioGPS gene expression data to be expressed in HEK293T.

Quick Database Links

Gene Symbol

CCDC7

UniProt

Q9H943

RefSeq (Protein):NP_078964