CCDC117 antibody

Catalog Number: orb582008

Catalog Number	orb582008
Category	Antibodies
Description	Rabbit polyclonal antibody to CCDC117
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast
Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Yeast
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	30kDa
Target	CCDC117
UniProt ID	Q8IWD4
Protein Sequence	Synthetic peptide located within the following region: GLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRN
NCBI	NP_775781
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	dJ366L4.1 Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.