You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294992 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant CCBL1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1B12 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | CCBL1 (AAH33685, 1 a.a. ~ 374 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP |
NCBI | AAH33685 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged CCBL1 is 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CCBL1 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of CCBL1 expression in transfected 293T cell line by CCBL1 monoclonal antibody (M02), clone 1B12. Lane 1: CCBL1 transfected lysate(27.4 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (66.88 KDa).