You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295000 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CBS protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CBS (NP_000062.1, 1 a.a. ~ 551 a.a) full-length human protein. |
Protein Sequence | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000062.1 |
CBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CBS expression in human pancreas.
CBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CBS expression in mouse kidney.
Western Blot analysis of CBS expression in transfected 293T cell line by CBS MaxPab polyclonal antibody. Lane 1: CBS transfected lysate(60.60 KDa). Lane 2: Non-transfected lysate.