CBFA2T2 Rabbit Polyclonal Antibody

• Catalog Number: orb576736
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CBFA2T2
• Target: CBFA2T2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T2
• Protein Sequence: Synthetic peptide located within the following region: AKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
• UniProt ID: O43439
• MW: 67kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EHT, p85, MTGR1, ZMYND3
• Note: For research use only
• NCBI: NP_005084

WB Suggested Anti-CBFA2T2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. CBFA2T2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.