Cbfa2t2 Rabbit Polyclonal Antibody

• Catalog Number: orb576332
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Cbfa2t2
• Target: Cbfa2t2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND
• UniProt ID: O70374
• MW: 66kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MTGR, MTGR1, Cbfa2t2h, A430091M07, C330013D05Rik
• Note: For research use only
• NCBI: NP_766448
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Cbfa2t2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Mouse Brain.