Cart summary

You have no items in your shopping cart.

CASP4 Peptide - N-terminal region

CASP4 Peptide - N-terminal region

Catalog Number: orb2001783

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001783
CategoryProteins
DescriptionCASP4 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW41kDa
UniProt IDP49662
Protein SequenceSynthetic peptide located within the following region: ADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALK
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesCASP4,ICH2,
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with CASP4 Rabbit Polyclonal Antibody (orb331503). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.