Cart summary

You have no items in your shopping cart.

CASP4 Peptide - N-terminal region

CASP4 Peptide - N-terminal region

Catalog Number: orb1999487

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999487
CategoryProteins
DescriptionCASP4 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW13 kDa
UniProt IDP49662
Protein SequenceSynthetic peptide located within the following region: KKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVM
NCBINP_001216.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesTX, ICH-2, Mih1/TX, ICEREL-II, ICE(rel)II
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.