CASP3 Rabbit Polyclonal Antibody

SKU: orb584188

Description

Rabbit polyclonal antibody to Caspase 3

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IF, IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CASP3
• Target: CASP3
• Protein Sequence: Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG
• Molecular Weight: 12kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CPP32, SCA-1, CPP32B

Immunofluorescent Caspase 3 detection in HeLa cells after induction of apoptosis (red fluorescence). Nuclei were stained with DAPI (blue fluorescence), Working dilution 5-15 ug/ml.

Rabbit Anti-CASP3 Antibody, Catalog Number: orb584188, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CASP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: THP-1 cell lysate.

Quick Database Links

Gene Symbol

CASP3

UniProt

P42574

RefSeq (Protein):NP_116786