Casp2 Rabbit Polyclonal Antibody

SKU: orb584187

Description

Rabbit polyclonal antibody to Casp2

Research Area

Cancer Biology, Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Casp2
• Target: Casp2
• Protein Sequence: Synthetic peptide located within the following region: DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHTQSPGCEESDAGK
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Casp, Ich-, Nedd, ICH-1, Nedd2, CASP-2, NEDD-2

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Type: Mouse Testis lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Casp2

UniProt

P29594

RefSeq (Protein):NP_031636