CAPZB Rabbit Polyclonal Antibody

• Catalog Number: orb331478
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAPZB
• Target: CAPZB
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPZB
• Protein Sequence: Synthetic peptide located within the following region: PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRK
• UniProt ID: P47756
• MW: 31 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CAPZB antibody, anti antibody
• Research Area: Stem Cell & Developmental Biology
• Note: For research use only

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml.