You have no items in your shopping cart.
Cart summary
Item 1 of 1
Capzb Rabbit Polyclonal Antibody
Catalog Number: orb330976
| Catalog Number | orb330976 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Capzb |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish |
| Reactivity | Rat |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Capzb |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 29kDa |
| Target | Capzb |
| UniProt ID | Q5XI32 |
| Protein Sequence | Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL |
| NCBI | NP_001005903 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti MGC95097 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Capzb Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Small Intestine.
- Item 1 of 6
- Item 1 of 3
- Item 1 of 2
Anti-CapZ beta Antibody [orb341433]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
CAPZB Antibody (N-term) [orb1931363]
WB
Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl
