CANX Rabbit Polyclonal Antibody

SKU: orb331067

Description

Rabbit polyclonal antibody to CANX

Research Area

Cell Biology, Protein Biochemistry, Signal Transduction

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human CANX
Target	CANX
Protein Sequence	Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
Molecular Weight	65kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti CNX antibody, anti FLJ26570 antibody, anti IP90 antibody, anti P90 antibody

Calnexin-CT Antibody (RPE) [orb152003]

Applications:	FC, ICC, IF, IHC, IP, WB
Reactivity:	Aves, Bovine, Canine, Drosophila, Frog, Gallus, Guinea pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	RPE

Sizes Available: 200 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-CANX Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.

Quick Database Links

Gene Symbol

CANX

UniProt

P27824

RefSeq (Protein):NP_001737

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001737

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols