You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820872 |
---|---|
Category | Proteins |
Description | The Canine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-6 Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM) (Gene ID: 403985). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 21.0 kDa |
Target | IL-6 |
Entrez | 403985 |
Protein Sequence | FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM |
Protein Length | 187 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
22.8 KDa | |
E.Coli |
Filter by Rating