CAND1 monoclonal antibody (M01), clone 5D7

• Catalog Number: orb2291000
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAND1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 5D7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_060918

CAND1 monoclonal antibody (M01), clone 5D7 Western Blot analysis of CAND1 expression in Hela S3 NE.

Detection limit for recombinant GST tagged CAND1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).