CAND1 monoclonal antibody (M01), clone 5D7

• Catalog Number: orb2291000
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAND1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5D7
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
• NCBI: NP_060918
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CAND1 monoclonal antibody (M01), clone 5D7 Western Blot analysis of CAND1 expression in Hela S3 NE.

Detection limit for recombinant GST tagged CAND1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).