TIP120A Rabbit Polyclonal Antibody

• Catalog Number: orb575155
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TIP120A
• Target: CAND1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TIP120A
• Protein Sequence: Synthetic peptide located within the following region: TVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADM
• UniProt ID: Q86VP6
• MW: 136kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TIP120, TIP120A
• Note: For research use only
• NCBI: NP_060918

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TIP120A Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.