CALHM5 Rabbit Polyclonal Antibody

SKU: orb587386

Description

CALHM5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CALHM5. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human FAM26E. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FAM26E
• Target: CALHM5
• Protein Sequence: Synthetic peptide located within the following region: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FAM26E, C6orf188, dJ493F7.3

Sample Type: Fetal Lung lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

CALHM5

UniProt

Q8N5C1

RefSeq (Protein):NP_714922