Calcitonin, salmon（）

SKU: orb2693838

Description

Calcitonin, salmon, also known as salmon calcitonin, is a calcitonin drug. Calcitonin is a peptide hormone secreted by thyroid C cells that inhibits calcium transfer in bones and lowers blood calcium levels. The main use of salmon calcitonin is to treat diseases such as osteoporosis, bone pain, and hypercalcemia.

Key Properties

• CAS Number: 47931-85-1
• MW: 3417.88
• Purity: ≥95%
• Formula: C₁₄₅H₂₄₀N₄₄O₄₈S₂
• Protein Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Disulfide bridge Cys1-Cys7)

Storage & Handling

• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only