Calcitonin, salmon（）

• Catalog Number: orb2693838
• Category: Proteins
• Description: Calcitonin, salmon, also known as salmon calcitonin, is a calcitonin drug. Calcitonin is a peptide hormone secreted by thyroid C cells that inhibits calcium transfer in bones and lowers blood calcium levels. The main use of salmon calcitonin is to treat diseases such as osteoporosis, bone pain, and hypercalcemia.
• Purity: ≥95%
• Protein Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Disulfide bridge Cys1-Cys7)
• MW: 3417.88
• CAS Number: 47931-85-1
• Formula: C₁₄₅H₂₄₀N₄₄O₄₈S₂
• Note: For research use only