You have no items in your shopping cart.
Cart summary
CADM4 Peptide - middle region
Catalog Number: orb2003298
| Catalog Number | orb2003298 |
|---|---|
| Category | Proteins |
| Description | CADM4 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA |
| UniProt ID | Q8NFZ8 |
| MW | 42kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with CADM4 Rabbit Polyclonal Antibody (orb331349). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | IGSF4C, NECL4, Necl-4, TSLL2, synCAM4 |
| Note | For research use only |
| NCBI | NP_660339 |
