You have no items in your shopping cart.
Cart summary
Item 1 of 1
Cacng3 Rabbit Polyclonal Antibody
Catalog Number: orb575401
| Catalog Number | orb575401 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Cacng3 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
| Reactivity | Mouse |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 35kDa |
| Target | Cacng3 |
| UniProt ID | Q9JJV5 |
| Protein Sequence | Synthetic peptide located within the following region: GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS |
| NCBI | NP_062303 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Cacng3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Mouse Liver.
- Item 1 of 2
Anti-CACNG3 Antibody [orb323238]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
CACNG3 Polyclonal Antibody [orb1415751]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
