CACNA2D1 Rabbit Polyclonal Antibody

SKU: orb329801

Description

Rabbit polyclonal antibody to CACNA2D1

Research Area

Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1
• Target: CACNA2D1
• Protein Sequence: Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
• Molecular Weight: 120kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CACNA2 antibody, anti CCHL2A antibody, anti CACNL2A antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Type: Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Positive control (+): Human Liver (LI), Negative control (-): MCF7 Cell Lysate (N10), Antibody concentration: 3 ug/mL.

WB Suggested Anti-CACNA2D1 Antibody Titration: 0.12 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

CACNA2D1

UniProt

P54289

RefSeq (Protein):NP_000713